Structure of PDB 2pon Chain B Binding Site BS01

Receptor Information
>2pon Chain B (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQAL
REAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDT
FVELYG
Ligand information
>2pon Chain A (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGTMENLSRRLKVTGDLFDIMSG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pon Molecular Basis of Bcl-xL's Target Recognition Versatility Revealed by the Structure of Bcl-xL in Complex with the BH3 Domain of Beclin-1.
ResolutionN/A
Binding residue
(original residue number in PDB)		E112 F113 Y117 F121 L124 Q127 L128 H129 S138 V142 E145 D149 N152 W153 G154 R155 F162 N201 T206 E209 L210 Y211
Binding residue
(residue number reindexed from 1)		E56 F57 Y61 F65 L68 Q71 L72 H73 S82 V86 E89 D93 N96 W97 G98 R99 F106 N145 T150 E153 L154 Y155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2pon, PDBe:2pon, PDBj:2pon
PDBsum2pon
PubMed17659302
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]