Structure of PDB 2pmc Chain B Binding Site BS01

Receptor Information
>2pmc Chain B (length=128) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF
GFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQA
GASGYVVKPFTAATLEEKLNKIFEKLGM
Ligand information
>2pmc Chain F (length=8) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLLDSLGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pmc Interaction of CheY with the C-terminal peptide of CheZ.
Resolution2.688 Å
Binding residue
(original residue number in PDB)		K92 I95 A99 A103 G105 Y106 K122
Binding residue
(residue number reindexed from 1)		K91 I94 A98 A102 G104 Y105 K121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006935 chemotaxis
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pmc, PDBe:2pmc, PDBj:2pmc
PDBsum2pmc
PubMed18083806
UniProtP0A2D5|CHEY_SALTY Chemotaxis protein CheY (Gene Name=cheY)

[Back to BioLiP]