Structure of PDB 2pfj Chain B Binding Site BS01

Receptor Information
>2pfj Chain B (length=130) Species: 10760 (Escherichia phage T7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVE
TAGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEK
HGIKFADKLIPAEWIKEPKKEVPFDRLKRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pfj The structural basis of Holliday junction resolution by T7 endonuclease I.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K40 H50 T51 Y52 T53 G68 R98
Binding residue
(residue number reindexed from 1)		K25 H35 T36 Y37 T38 G53 R83
Enzymatic activity
Enzyme Commision number 3.1.21.2: deoxyribonuclease IV.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0008821 crossover junction DNA endonuclease activity
GO:0008833 deoxyribonuclease IV (phage-T4-induced) activity
GO:1990238 double-stranded DNA endonuclease activity
Biological Process
GO:0015074 DNA integration
GO:0016032 viral process
GO:0039657 symbiont-mediated suppression of host gene expression
GO:0099015 degradation of host chromosome by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2pfj, PDBe:2pfj, PDBj:2pfj
PDBsum2pfj
PubMed17873858
UniProtP00641|ENDO_BPT7 Endonuclease I (Gene Name=3)

[Back to BioLiP]