Structure of PDB 2pem Chain B Binding Site BS01

Receptor Information
>2pem Chain B (length=111) Species: 32049 (Picosynechococcus sp. PCC 7002) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPI
QESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGN
HRRSLLERLTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pem Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		S16 Y17 Y20 I50 Q51
Binding residue
(residue number reindexed from 1)		S16 Y17 Y20 I50 Q51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042803 protein homodimerization activity
GO:0044183 protein folding chaperone
Biological Process
GO:0006457 protein folding
GO:0015977 carbon fixation
GO:0015979 photosynthesis
GO:0110102 ribulose bisphosphate carboxylase complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0031470 carboxysome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pem, PDBe:2pem, PDBj:2pem
PDBsum2pem
PubMed17574029
UniProtQ44177|RBCX_PICP2 RuBisCO chaperone RbcX (Gene Name=rbcX)

[Back to BioLiP]