Structure of PDB 2p8p Chain B Binding Site BS01

Receptor Information
>2p8p Chain B (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWL
AIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHR
RGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQ
TYTCNVNHKPSNTKVDKRVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2p8p Structural details of HIV-1 recognition by the broadly neutralizing monoclonal antibody 2F5: epitope conformation, antigen-recognition loop mobility, and anion-binding site.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		G33 Y52 D54 D56 R58 R95 P98 P100E A100G R100H V100K
Binding residue
(residue number reindexed from 1)		G33 Y54 D56 D58 R60 R100 P103 P110 A112 R113 V116
External links