Structure of PDB 2p7c Chain B Binding Site BS01

Receptor Information

>2p7c Chain B (length=82) Species: 1402 (Bacillus licheniformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLR
LIKKGALNHHKEGRVFVYTPNIDESDYIEVKS

Ligand information

>2p7c Chain A (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaagtattacat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2p7c Conformational and thermodynamic changes of the repressor/DNA operator complex upon monomerization shed new light on regulation mechanisms of bacterial resistance against beta-lactam antibiotics.
Resolution	N/A
Binding residue (original residue number in PDB)	N25 T26 N27 Q45 L49 R50 H59 K61 V65 F66
Binding residue (residue number reindexed from 1)	N25 T26 N27 Q45 L49 R50 H59 K61 V65 F66
Binding affinity	PDBbind-CN: Kd=190uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0045892	negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2p7c, PDBe:2p7c, PDBj:2p7c
PDBsum	2p7c
PubMed	17576674
UniProt	P06555\|BLAI_BACLI Penicillinase repressor (Gene Name=blaI)

[Back to BioLiP]