Structure of PDB 2p59 Chain B Binding Site BS01

Receptor Information

>2p59 Chain B (length=181) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCING
VCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHA
VGLFRAAVCTRGVAKAVDFIPVENLETTMRS

Ligand information

>2p59 Chain C (length=16) Species: 63746 (Hepatitis C virus (isolate H77)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GSVVIVGRIVLSGKPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2p59 Inhibitors of hepatitis C virus NS3.4A protease. Effect of P4 capping groups on inhibitory potency and pharmacokinetics.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	T1030 Y1032 A1033
Binding residue (residue number reindexed from 1)	T4 Y6 A7

Enzymatic activity

Catalytic site (original residue number in PDB)	H1083 D1107 G1163 S1165
Catalytic site (residue number reindexed from 1)	H57 D81 G137 S139
Enzyme Commision number	3.6.4.13: RNA helicase.

Gene Ontology

	Molecular Function
GO:0008233	peptidase activity
GO:0008236	serine-type peptidase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006508	proteolysis
GO:0019062	virion attachment to host cell
GO:0019087	transformation of host cell by virus
GO:0046718	symbiont entry into host cell
GO:0097264	self proteolysis

	Cellular Component
GO:0016020	membrane
GO:0033644	host cell membrane
GO:0044423	virion component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2p59, PDBe:2p59, PDBj:2p59
PDBsum	2p59
PubMed	17482818
UniProt	Q91RS4

[Back to BioLiP]