Structure of PDB 2oyh Chain B Binding Site BS01

Receptor Information
>2oyh Chain B (length=298) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSV
DFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTEL
LIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQL
MGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAA
NPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oyh Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
L360 N364 M367 W385 E397 D398 R406 C407 H408 T431 D432 M438
Binding residue
(residue number reindexed from 1)
L200 N204 M207 W225 E237 D238 R246 C247 H248 T271 D272 M278
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
Biological Process
GO:0007596 blood coagulation
GO:0030168 platelet activation
GO:0051258 protein polymerization
Cellular Component
GO:0005577 fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2oyh, PDBe:2oyh, PDBj:2oyh
PDBsum2oyh
PubMed17411074
UniProtP02675|FIBB_HUMAN Fibrinogen beta chain (Gene Name=FGB)

[Back to BioLiP]