Structure of PDB 2otu Chain B Binding Site BS01

Receptor Information
>2otu Chain B (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQPGGSLKLSCAASGFTFRDYYMYWVRQTPEKRLEWVAF
ISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARGR
GYVWFAYWGQGTTVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2otu Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
Resolution1.68 Å
Binding residue
(original residue number in PDB)		D31 Y32 Y33 Y35 G99 G101 Y102
Binding residue
(residue number reindexed from 1)		D31 Y32 Y33 Y35 G99 G101 Y102
Enzymatic activity
Enzyme Commision number ?
External links