Structure of PDB 2ol3 Chain B Binding Site BS01

Receptor Information
>2ol3 Chain B (length=113) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTL
RSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSADRVGN
TLYFGEGSRLIVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ol3 How much can a T-cell antigen receptor adapt to structurally distinct antigenic peptides?
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D97 R98 V99
Binding residue
(residue number reindexed from 1)		D96 R97 V98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042605 peptide antigen binding
Biological Process
GO:0002250 adaptive immune response
Cellular Component
GO:0042101 T cell receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ol3, PDBe:2ol3, PDBj:2ol3
PDBsum2ol3
PubMed17363906
UniProtP04214|TVB6_MOUSE T-cell receptor beta chain V region E1

[Back to BioLiP]