Structure of PDB 2ok9 Chain B Binding Site BS01

Receptor Information
>2ok9 Chain B (length=121) Species: 113192 (Bothrops pirajai) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGKPKDATDRCCYVHKCC
YKKLTGCNPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENL
GTYNKLYRYHLKPFCKKADDC
Ligand information
Ligand IDPBP
InChIInChI=1S/C8H6Br2O/c9-5-8(11)6-1-3-7(10)4-2-6/h1-4H,5H2
InChIKeyFKJSFKCZZIXQIP-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.385BrCC(=O)c1ccc(Br)cc1
OpenEye OEToolkits 2.0.7c1cc(ccc1C(=O)CBr)Br
ACDLabs 12.01C(C(c1ccc(cc1)Br)=O)Br
FormulaC8 H6 Br2 O
Namep-Bromophenacyl bromide
ChEMBLCHEMBL142826
DrugBank
ZINCZINC000000028146
PDB chain2ok9 Chain B Residue 248 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ok9 Crystal structure of a phospholipase A(2) homolog complexed with p-bromophenacyl bromide reveals important structural changes associated with the inhibition of myotoxic activity.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		Y22 G23 C29 G30 C45 H48 K49
Binding residue
(residue number reindexed from 1)		Y21 G22 C28 G29 C44 H47 K48
Annotation score1
Enzymatic activity
Catalytic site (original residue number in PDB) N28 G30 L32 H48 K49 Y52 Y73 D99
Catalytic site (residue number reindexed from 1) N27 G29 L31 H47 K48 Y51 Y64 D89
Enzyme Commision number 3.1.1.4: phospholipase A2.
Gene Ontology
Molecular Function
GO:0004623 phospholipase A2 activity
GO:0005509 calcium ion binding
GO:0005543 phospholipid binding
GO:0047498 calcium-dependent phospholipase A2 activity
GO:0090729 toxin activity
Biological Process
GO:0006644 phospholipid metabolic process
GO:0016042 lipid catabolic process
GO:0035821 modulation of process of another organism
GO:0042130 negative regulation of T cell proliferation
GO:0050482 arachidonate secretion
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ok9, PDBe:2ok9, PDBj:2ok9
PDBsum2ok9
PubMed19616648
UniProtP58399|PA2H1_BOTPI Basic phospholipase A2 homolog piratoxin-1

[Back to BioLiP]