Structure of PDB 2obh Chain B Binding Site BS01

Receptor Information
>2obh Chain B (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISE
IDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKN
LKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2obh Structural, thermodynamic, and cellular characterization of human centrin 2 interaction with xeroderma pigmentosum group C protein.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K108 F113 V129 E132 M145 M166 K168
Binding residue
(residue number reindexed from 1)		K83 F88 V104 E107 M120 M141 K143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2obh, PDBe:2obh, PDBj:2obh
PDBsum2obh
PubMed17897675
UniProtP41208|CETN2_HUMAN Centrin-2 (Gene Name=CETN2)

[Back to BioLiP]