Structure of PDB 2o9i Chain B Binding Site BS01

Receptor Information

>2o9i Chain B (length=279) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSREEAAKWSQVRK
DLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGI
ISFAKVISYFRDLPIEDQISLLKGAAFELSQLRFNTVFNAETGTWECGRL
SYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRP
GVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSIN
AQHTQRLLRIQDIHPFATPLMQELFGITG

Ligand information

>2o9i Chain D (length=15) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SLTERHKILHRLLQE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2o9i Crystal structure of the PXR-T1317 complex provides a scaffold to examine the potential for receptor antagonism.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	I1255 K1259 I1269 E1270 Q1272 I1273 K1277 E1427
Binding residue (residue number reindexed from 1)	I101 K105 I115 E116 Q118 I119 K123 E273

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2o9i, PDBe:2o9i, PDBj:2o9i
PDBsum	2o9i
PubMed	17215127
UniProt	O75469\|NR1I2_HUMAN Nuclear receptor subfamily 1 group I member 2 (Gene Name=NR1I2)

[Back to BioLiP]