Structure of PDB 2o88 Chain B Binding Site BS01

Receptor Information

>2o88 Chain B (length=56) Species: 9606 (Homo sapiens)

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
AYITPV

Ligand information

>2o88 Chain D (length=10) Species: 32630 (synthetic construct)

APSYSPPPPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2o88 Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
• Resolution: 1.75 Å
• Binding residue (original residue number in PDB): Y70 D77 W99 W110 Y115
• Binding residue (residue number reindexed from 1): Y7 D14 W36 W47 Y52

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:2o88, PDBe:2o88, PDBj:2o88
• PDBsum: 2o88
• PubMed: 17452790
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)