Structure of PDB 2o61 Chain B Binding Site BS01

Receptor Information

>2o61 Chain B (length=314) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICN
YVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFAN
LGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQL
GDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDA
IYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEE
ENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSD
LETSEPKPFLYYPE

Ligand information

>2o61 Chain E (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgaaagggagaagtgaaagtgggaaattcctctgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2o61 An Atomic Model of the Interferon-beta Enhanceosome.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	R54 R56 S63 H64 G65
Binding residue (residue number reindexed from 1)	R18 R20 S27 H28 G29

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2o61, PDBe:2o61, PDBj:2o61
PDBsum	2o61
PubMed	17574024
UniProt	P19838\|NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit (Gene Name=NFKB1)

[Back to BioLiP]