Structure of PDB 2nxq Chain B Binding Site BS01

Receptor Information

>2nxq Chain B (length=64) Species: 294381 (Entamoeba histolytica HM-1:IMSS)

AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNG
EIDQNEFAKFYGSI

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 2nxq Chain B Residue 151

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2nxq Crystal structure of calcium binding protein-1 from Entamoeba histolytica: A novel arrangement of EF hand motifs.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): D10 N12 D14 A16 E21
• Binding residue (residue number reindexed from 1): D9 N11 D13 A15 E20
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0003785 actin monomer binding
• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding
• GO:0051015 actin filament binding

Biological Process

• GO:0006909 phagocytosis
• GO:0032231 regulation of actin filament bundle assembly
• GO:0045859 regulation of protein kinase activity
• GO:0050766 positive regulation of phagocytosis
• GO:1905303 positive regulation of macropinocytosis

Cellular Component

• GO:0001891 phagocytic cup
• GO:0005737 cytoplasm
• GO:0031143 pseudopodium
• GO:0042995 cell projection

External links

• PDB: RCSB:2nxq, PDBe:2nxq, PDBj:2nxq
• PDBsum: 2nxq
• PubMed: 17554780
• UniProt: P38505|CABP1_ENTH1 Calcium-binding protein 1 (Gene Name=CaBP1)