Structure of PDB 2nud Chain B Binding Site BS01

Receptor Information
>2nud Chain B (length=291) Species: 318 (Pseudomonas savastanoi pv. glycinea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRALPGPSQRQLEVYDQCLIGAARWPDDKSNTPENRAYCQSMYNSIRSAG
DEISRGGITSFEELWGRATEWRLSKLEPLYSAFASERTSDTDAVTPLVKP
YKSVLARVVDHEDAHDEIMQDNLFGDLNVKVYRQTAYLHGNVIPLNTFRV
ATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHL
NDLYRQAISSDLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIA
SAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDCF
Ligand information
>2nud Chain D (length=23) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KFGDWDENNPSSADGYTHIFNKV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nud Type III Effector Activation via Nucleotide Binding, Phosphorylation, and Host Target Interaction.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S119 D120 T121 D122 A123 V124 T125 P126 Y131 V139 T184 L187 R188 V191 L203 K204 L207 Q208 R209 P212 D213 N219 M262 Q265 R266
Binding residue
(residue number reindexed from 1)		S89 D90 T91 D92 A93 V94 T95 P96 Y101 V109 T154 L157 R158 V161 L173 K174 L177 Q178 R179 P182 D183 N189 M232 Q235 R236
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:2nud, PDBe:2nud, PDBj:2nud
PDBsum2nud
PubMed17397263
UniProtP13835|AVRB_PSESG Avirulence protein B (Gene Name=avrB)

[Back to BioLiP]