Structure of PDB 2ntz Chain B Binding Site BS01

Receptor Information
>2ntz Chain B (length=172) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIREIGLRLMRMKNDGMSQKDIAAKEGLSQAKVTRALQAASAPEELVALF
PVQSELTFSDYKTLCAVGDEMGNKNLEFDQLIQNISPEINDILSIEEMAE
DEVKNKILRLITKEASLLTDKSVVTELWKFEDKDRFARKRVKGRAFSYEF
NRLSKELQEELDRMIGHILRKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ntz Structure of a four-way bridged ParB-DNA complex provides insight into P1 segrosome assembly.
Resolution3.35 Å
Binding residue
(original residue number in PDB)
K287 D288 R292
Binding residue
(residue number reindexed from 1)
K133 D134 R138
Binding affinityPDBbind-CN: Kd=49nM
Enzymatic activity
Enzyme Commision number ?
External links