Structure of PDB 2nny Chain B Binding Site BS01

Receptor Information
>2nny Chain B (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSSQSFISWT
GDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAG
KRYVYRFVSDLQSLLGYTPEELHAMLDVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nny Regulation of the transcription factor Ets-1 by DNA-mediated homo-dimerization.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		Q336 L337 K379 K381 M384 K388 R391 Y395 Y396
Binding residue
(residue number reindexed from 1)		Q29 L30 K72 K74 M77 K81 R84 Y88 Y89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2nny, PDBe:2nny, PDBj:2nny
PDBsum2nny
PubMed18566588
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]