Structure of PDB 2n82 Chain B Binding Site BS01

Receptor Information
>2n82 Chain B (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERG
SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNP
YTNG
Ligand information
>2n82 Chain A (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaguuuuggcaugacucuacc
.<<<<.............>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2n82 Rbfox proteins regulate microRNA biogenesis by sequence-specific binding to their precursors and target downstream Dicer.
ResolutionN/A
Binding residue
(original residue number in PDB)		R118 H120 S122 N123 I124 P125 F126 I149 F150 N151 E152 R153 G154 S155 K156 G157 F158 F160 R184 N189 N190 A191 T192 A193 R194 V195 N198 K199 K200 N203 Y205 T206
Binding residue
(residue number reindexed from 1)		R14 H16 S18 N19 I20 P21 F22 I45 F46 N47 E48 R49 G50 S51 K52 G53 F54 F56 R80 N85 N86 A87 T88 A89 R90 V91 N94 K95 K96 N99 Y101 T102
Binding affinityPDBbind-CN: Kd=21.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0000381 regulation of alternative mRNA splicing, via spliceosome
GO:0007399 nervous system development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2n82, PDBe:2n82, PDBj:2n82
PDBsum2n82
PubMed27001519
UniProtQ9NWB1|RFOX1_HUMAN RNA binding protein fox-1 homolog 1 (Gene Name=RBFOX1)

[Back to BioLiP]