Structure of PDB 2n4q Chain B Binding Site BS01

Receptor Information
>2n4q Chain B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLC
SLDKTTVRKLQSYLETSGTS
Ligand information
>2n4q Chain A (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TQGGRPSLIARIPVARILGDPEEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2n4q Solution NMR Structure of CBX8 in complex with AF9 (CBX8-AF9)
ResolutionN/A
Binding residue
(original residue number in PDB)		H511 V527 F543 D544 F545 L547
Binding residue
(residue number reindexed from 1)		H13 V29 F45 D46 F47 L49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2n4q, PDBe:2n4q, PDBj:2n4q
PDBsum2n4q
PubMed
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]