Structure of PDB 2mwn Chain B Binding Site BS01

Receptor Information
>2mwn Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIK
RWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Ligand information
>2mwn Chain A (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DIDQMFSTLLGEMDLLTQSLGVDT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mwn Conformational activation of talin by RIAM triggers integrin-mediated cell adhesion.
ResolutionN/A
Binding residue
(original residue number in PDB)		K318 A360 S365 T367 Y377 S379 V380
Binding residue
(residue number reindexed from 1)		K11 A53 S58 T60 Y70 S72 V73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:2mwn, PDBe:2mwn, PDBj:2mwn
PDBsum2mwn
PubMed25520155
UniProtQ9Y490|TLN1_HUMAN Talin-1 (Gene Name=TLN1)

[Back to BioLiP]