Structure of PDB 2mvd Chain B Binding Site BS01

Receptor Information
>2mvd Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGEQGFFYTPKT
Ligand information
>2mvd Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mvd Structural and Functional Study of the GlnB22-Insulin Mutant Responsible for Maturity-Onset Diabetes of the Young.
ResolutionN/A
Binding residue
(original residue number in PDB)		F31 Q34 H35 C37 L41 L45 C49
Binding residue
(residue number reindexed from 1)		F1 Q4 H5 C7 L11 L15 C19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2mvd, PDBe:2mvd, PDBj:2mvd
PDBsum2mvd
PubMed25423173
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]