Structure of PDB 2msr Chain B Binding Site BS01

Receptor Information
>2msr Chain B (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNAASRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQ
QAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNM
Ligand information
>2msr Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGSGEDEQFLGFGSDEEVRVR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2msr Validation and Structural Characterization of the LEDGF/p75-MLL Interface as a New Target for the Treatment of MLL-Dependent Leukemia.
ResolutionN/A
Binding residue
(original residue number in PDB)		L363 F406 V408
Binding residue
(residue number reindexed from 1)		L25 F68 V70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2msr, PDBe:2msr, PDBj:2msr
PDBsum2msr
PubMed25082813
UniProtO75475|PSIP1_HUMAN PC4 and SFRS1-interacting protein (Gene Name=PSIP1)

[Back to BioLiP]