Structure of PDB 2mpg Chain B Binding Site BS01

Receptor Information
>2mpg Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCASHLVEALYLVCGERGFFYTKPT
Ligand information
>2mpg Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mpg Insight into the structural and biological relevance of the T/R transition of the N-terminus of the B-chain in human insulin.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 C19 Y26
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 C19 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2mpg, PDBe:2mpg, PDBj:2mpg
PDBsum2mpg
PubMed24819248
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]