Structure of PDB 2mp2 Chain B Binding Site BS01

Receptor Information
>2mp2 Chain B (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQ
GLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQT
Ligand information
>2mp2 Chain C (length=25) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVGDEIVDLTCESLEPVVVDLTHND
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mp2 Structural insight into SUMO chain recognition and manipulation by the ubiquitin ligase RNF4.
ResolutionN/A
Binding residue
(original residue number in PDB)		K5 N14 Q30 K32 I33 K34 T37 K41 R49
Binding residue
(residue number reindexed from 1)		K5 N14 Q30 K32 I33 K34 T37 K41 R49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mp2, PDBe:2mp2, PDBj:2mp2
PDBsum2mp2
PubMed24969970
UniProtP55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 (Gene Name=SUMO3)

[Back to BioLiP]