Structure of PDB 2mli Chain B Binding Site BS01

Receptor Information
>2mli Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSDLVEALYLVCGERGFFYTKPT
Ligand information
>2mli Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mli Protective hinge in insulin opens to enable its receptor engagement.
ResolutionN/A
Binding residue
(original residue number in PDB)		F22 N24 Q25 H26 L27 C28 L32 A35 L36 V39 C40 R43 G44 F45 X46 Y47
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 A14 L15 V18 C19 R22 G23 F24 X25 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2mli, PDBe:2mli, PDBj:2mli
PDBsum2mli
PubMed25092300
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]