Structure of PDB 2mb0 Chain B Binding Site BS01

Receptor Information
>2mb0 Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRG
FAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mb0 Characterization of the RNA recognition mode of hnRNP G extends its role in SMN2 splicing regulation.
ResolutionN/A
Binding residue
(original residue number in PDB)		K9 F11 L38 M40 R49 F51 F53 A78 I79 K80 T85 P87 F89
Binding residue
(residue number reindexed from 1)		K9 F11 L38 M40 R49 F51 F53 A78 I79 K80 T85 P87 F89
Binding affinityPDBbind-CN: Kd=18uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2mb0, PDBe:2mb0, PDBj:2mb0
PDBsum2mb0
PubMed24692659
UniProtP38159|RBMX_HUMAN RNA-binding motif protein, X chromosome (Gene Name=RBMX)

[Back to BioLiP]