Structure of PDB 2m8d Chain B Binding Site BS01

Receptor Information

>2m8d Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRD
GTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDG

Ligand information

>2m8d Chain A (length=8) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugaaggac

........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2m8d Isolated pseudo-RNA-recognition motifs of SR proteins can regulate splicing using a noncanonical mode of RNA recognition.
Resolution	N/A
Binding residue (original residue number in PDB)	P108 R109 Y112 P115 S116 R117 S133 W134 Q135 D136 K138 D139 Y149 A150 D151 Y153 R154 H183 E184
Binding residue (residue number reindexed from 1)	P3 R4 Y7 P10 S11 R12 S28 W29 Q30 D31 K33 D34 Y44 A45 D46 Y48 R49 H78 E79
Binding affinity	PDBbind-CN: Kd=0.8uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:2m8d, PDBe:2m8d, PDBj:2m8d
PDBsum	2m8d
PubMed	23836656
UniProt	Q07955\|SRSF1_HUMAN Serine/arginine-rich splicing factor 1 (Gene Name=SRSF1)

[Back to BioLiP]