Structure of PDB 2m41 Chain B Binding Site BS01

Receptor Information
>2m41 Chain B (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTV
ERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERT
SQLFDLPCSKLSVGDVCISLTLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m41 Protein-Protein Interactions as a Strategy towards Protein-Specific Drug Design: The Example of Ataxin-1.
ResolutionN/A
Binding residue
(original residue number in PDB)		P573 Y574 F575 I580 I581 Q582 L583 A584 V591 F599 S602 A603 F632 A639 V643 P650 F651 W658 S685 L686 L688
Binding residue
(residue number reindexed from 1)		P7 Y8 F9 I14 I15 Q16 L17 A18 V25 F33 S36 A37 F66 A73 V77 P84 F85 W92 S119 L120 L122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2m41, PDBe:2m41, PDBj:2m41
PDBsum2m41
PubMed24155902
UniProtP54253|ATX1_HUMAN Ataxin-1 (Gene Name=ATXN1)

[Back to BioLiP]