Structure of PDB 2m2o Chain B Binding Site BS01

Receptor Information
>2m2o Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGHFYTPKT
Ligand information
>2m2o Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m2o Structural integrity of the B24 site in human insulin is important for hormone functionality.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 H5 L6 C7 L11 V18 C19
Binding residue
(residue number reindexed from 1)		F1 H5 L6 C7 L11 V18 C19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2m2o, PDBe:2m2o, PDBj:2m2o
PDBsum2m2o
PubMed23447530
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]