Structure of PDB 2lup Chain B Binding Site BS01

Receptor Information
>2lup Chain B (length=90) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLG
TGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Ligand information
>2lup Chain A (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggauaccauguucagaagaacgugguaucuc
<<<<<<<<<<<<<<....>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lup Structure of a yeast RNase III dsRBD complex with a noncanonical RNA substrate provides new insights into binding specificity of dsRBDs.
ResolutionN/A
Binding residue
(original residue number in PDB)		K371 R372 Y375 S376 P393 A395 N419
Binding residue
(residue number reindexed from 1)		K8 R9 Y12 S13 P30 A32 N56
Binding affinityPDBbind-CN: Kd=34.1uM
Enzymatic activity
Enzyme Commision number 3.1.26.3: ribonuclease III.
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding
Biological Process
GO:0006364 rRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2lup, PDBe:2lup, PDBj:2lup
PDBsum2lup
PubMed21742266
UniProtQ02555|RNT1_YEAST Ribonuclease 3 (Gene Name=RNT1)

[Back to BioLiP]