Structure of PDB 2ltt Chain B Binding Site BS01

Receptor Information
>2ltt Chain B (length=74) Species: 272623 (Lactococcus lactis subsp. lactis Il1403) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWSPDHEK
MGKGITLSEEEFGVLLKELGNKLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ltt Structures of apo- and ssDNA-bound YdbC from Lactococcus lactis uncover the function of protein domain family DUF2128 and expand the single-stranded DNA-binding domain proteome.
ResolutionN/A
Binding residue
(original residue number in PDB)		M1 L5 F7 A20 K21 W23 W32 N33 A35 K38 D40 R42 T43 K50 M51 G52 K53 T56 S58
Binding residue
(residue number reindexed from 1)		M1 L5 F7 A20 K21 W23 W32 N33 A35 K38 D40 R42 T43 K50 M51 G52 K53 T56 S58
Binding affinityPDBbind-CN: Kd=16nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ltt, PDBe:2ltt, PDBj:2ltt
PDBsum2ltt
PubMed23303792
UniProtQ9CIP3

[Back to BioLiP]