Structure of PDB 2lsp Chain B Binding Site BS01

Receptor Information
>2lsp Chain B (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDV
EALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKY
NPPDHEVVAMARKLQDVFEMRFAKMPDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lsp Down-regulation of NF-kappa B transcriptional activity in HIV-associated kidney disease by BRD4 inhibition.
ResolutionN/A
Binding residue
(original residue number in PDB)		W374 P375 F376 V380 L385 G386 L387 D389 D392 I393 C429 Y432 N433 H437 E438 V439
Binding residue
(residue number reindexed from 1)		W42 P43 F44 V48 L53 G54 L55 D57 D60 I61 C97 Y100 N101 H105 E106 V107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2lsp, PDBe:2lsp, PDBj:2lsp
PDBsum2lsp
PubMed22645123
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]