Structure of PDB 2lgb Chain B Binding Site BS01

Receptor Information
>2lgb Chain B (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKTR
Ligand information
>2lgb Chain A (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCNG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lgb Recombinant A22(G)-B31 (R)-human insulin. A22 addition introduces conformational mobility in B chain C-terminus.
ResolutionN/A
Binding residue
(original residue number in PDB)		F101 N103 Q104 H105 L106 C107 L111 L115 V118 C119 G123 R131
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 G23 R31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2lgb, PDBe:2lgb, PDBj:2lgb
PDBsum2lgb
PubMed22350952
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]