Structure of PDB 2l2k Chain B Binding Site BS01

Receptor Information
>2l2k Chain B (length=71) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRN
KKLAKARAAQSALATVFNLHL
Ligand information
>2l2k Chain A (length=42) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaagguggguggaauccuucgggaucccaccuacccugcc
<<<<.<<<<<<<<<.<<<<....>>>>.>>>>>>>>>.>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l2k The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
ResolutionN/A
Binding residue
(original residue number in PDB)		P43 K46 N47 M50 E54 S70 H71 F75 R91 N92 K93 K94 K97
Binding residue
(residue number reindexed from 1)		P1 K4 N5 M8 E12 S28 H29 F33 R49 N50 K51 K52 K55
Binding affinityPDBbind-CN: Kd=370nM
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
External links
PDB RCSB:2l2k, PDBe:2l2k, PDBj:2l2k
PDBsum2l2k
PubMed20946981
UniProtQ91ZS8|RED1_MOUSE Double-stranded RNA-specific editase 1 (Gene Name=Adarb1)

[Back to BioLiP]