Structure of PDB 2l1z Chain B Binding Site BS01

Receptor Information
>2l1z Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSDLVEALYLVCGERGFFYTKPT
Ligand information
>2l1z Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GLLEQCCHSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l1z Chiral Protein Engineering and its Application in G Health
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 A14 L15 C19 G23 F24 F25 Y26 T27
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 A14 L15 C19 G23 F24 F25 Y26 T27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2l1z, PDBe:2l1z, PDBj:2l1z
PDBsum2l1z
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]