Structure of PDB 2kxn Chain B Binding Site BS01

Receptor Information
>2kxn Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQS
RRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kxn Molecular basis of purine-rich RNA recognition by the human SR-like protein Tra2-beta1
ResolutionN/A
Binding residue
(original residue number in PDB)		R111 F123 G124 S148 I149 V150 R159 F161 F163 Y165 R187 R188 R190 S194 I195 T196 K197 R198 P199 H200
Binding residue
(residue number reindexed from 1)		R6 F18 G19 S43 I44 V45 R54 F56 F58 Y60 R82 R83 R85 S89 I90 T91 K92 R93 P94 H95
Binding affinityPDBbind-CN: Kd=2.25uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2kxn, PDBe:2kxn, PDBj:2kxn
PDBsum2kxn
PubMed21399644
UniProtP62995|TRA2B_HUMAN Transformer-2 protein homolog beta (Gene Name=TRA2B)

[Back to BioLiP]