Structure of PDB 2kxk Chain B Binding Site BS01

Receptor Information
>2kxk Chain B (length=32) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKTKR
Ligand information
>2kxk Chain A (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCNG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kxk Novel recombinant insulin analogue with flexible C - terminus in B chain. NMR structure of biosynthetic engineered A22G-B31K-B32R human insulin monomer in water /acetonitrile solution.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 Y26 P28 R32
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 Y26 P28 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2kxk, PDBe:2kxk, PDBj:2kxk
PDBsum2kxk
PubMed21704065
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]