Structure of PDB 2ktb Chain B Binding Site BS01

Receptor Information
>2ktb Chain B (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYA
IIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKD
ANSIKKIFYMKKAEIEHHEMA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ktb Structural insights into selective histone H3 recognition by the human Polybromo bromodomain 2.
ResolutionN/A
Binding residue
(original residue number in PDB)		N198 S200 R202 L203 E206 L207 N263 Q268 D272
Binding residue
(residue number reindexed from 1)		N26 S28 R30 L31 E34 L35 N91 Q96 D100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006338 chromatin remodeling
Cellular Component
GO:0016586 RSC-type complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ktb, PDBe:2ktb, PDBj:2ktb
PDBsum2ktb
PubMed20368734
UniProtQ86U86|PB1_HUMAN Protein polybromo-1 (Gene Name=PBRM1)

[Back to BioLiP]