Structure of PDB 2kjj Chain B Binding Site BS01

Receptor Information
>2kjj Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTKPT
Ligand information
>2kjj Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kjj Dynamics of Insulin Probed by 1H-NMR Amide Proton E Anomalous Flexibility of the Receptor-Binding Surfa
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 A14 L15 V18 C19 G23 F24 Y26
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 A14 L15 V18 C19 G23 F24 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2kjj, PDBe:2kjj, PDBj:2kjj
PDBsum2kjj
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]