Structure of PDB 2k6t Chain B Binding Site BS01

Receptor Information
>2k6t Chain B (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTPEMREKLCGHHFVRALVRVCGGPRWSTEA
Ligand information
>2k6t Chain A (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAATNPARYCCLSGCTQQDLLTLCPY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k6t Solution structure of a conformationally restricted fully active derivative of the human relaxin-like factor
ResolutionN/A
Binding residue
(original residue number in PDB)		E28 R30 E31 K32 L33 C34 F38 A41 L42 V45 C46 G48
Binding residue
(residue number reindexed from 1)		E4 R6 E7 K8 L9 C10 F14 A17 L18 V21 C22 G24
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2k6t, PDBe:2k6t, PDBj:2k6t
PDBsum2k6t
PubMed19086273
UniProtP51460|INSL3_HUMAN Insulin-like 3 (Gene Name=INSL3)

[Back to BioLiP]