Structure of PDB 2jum Chain B Binding Site BS01

Receptor Information
>2jum Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSDLVEALYLVCGERGFFYTKPT
Ligand information
>2jum Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GITEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jum The A-chain of Insulin Contacts the Insert Domain of the Insulin Receptor: PHOTO-CROSS-LINKING AND MUTAGENESIS OF A DIABETES-RELATED CREVICE.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 Q4 H5 L6 C7 L11 A14 L15 V18 C19 G23 F25 P29
Binding residue
(residue number reindexed from 1)		F1 Q4 H5 L6 C7 L11 A14 L15 V18 C19 G23 F25 P29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2jum, PDBe:2jum, PDBj:2jum
PDBsum2jum
PubMed17884811
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]