Structure of PDB 2jea Chain B Binding Site BS01

Receptor Information
>2jea Chain B (length=234) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPKLILDDGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAA
VYGPKEMHPRHLSLPDRAVLRVRYHMTPFSTDERKNPAPSRREIELSKVI
REALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGIPM
RDLIAGVAVGKADGVIILDLNETEAMWGEADMPIAMMPSLNQVTLFQLNG
SMTPDEFRQAFDLAVKGINIIYNLEREALKSKYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jea RNA Channelling by the Archaeal Exosome.
Resolution2.33 Å
Binding residue
(original residue number in PDB)		H65 T88 D89 R98 R99 A134 A136 S138 E179
Binding residue
(residue number reindexed from 1)		H58 T81 D82 R91 R92 A127 A129 S131 E172
Enzymatic activity
Enzyme Commision number 3.1.13.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003723 RNA binding
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006401 RNA catabolic process
GO:0016075 rRNA catabolic process
Cellular Component
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2jea, PDBe:2jea, PDBj:2jea
PDBsum2jea
PubMed17380186
UniProtQ9UXC2|RRP41_SACS2 Exosome complex component Rrp41 (Gene Name=rrp41)

[Back to BioLiP]