Structure of PDB 2j37 Chain B Binding Site BS01

Receptor Information
>2j37 Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLE
KNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIP
KLKTRTQ
Ligand information
>2j37 Chain A (length=128) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacacuaaguucggcaucaauauggugaccucccgggagcgggggaccac
cagguugccuaaggaggggugaaccggcccaggucggaaacggagcaggu
caaaacucccgugcugaucaguaguguc
<<<<<<<.<.<<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>
>>.>>>>........<<<<<.....<<<<..<.<<<....>>>..>.>>>
>...>>>>>.>>>>>>>.>..>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2j37 Following the signal sequence from ribosomal tunnel exit to signal recognition particle.
Resolution8.7 Å
Binding residue
(original residue number in PDB)
R14 F15 I16 C17 Y19 Y22 T28 I29 R33 R34 P36 K66 M67 Y68 S69 R70 R74 R81 R83 R101
Binding residue
(residue number reindexed from 1)
R1 F2 I3 C4 Y6 Y9 T15 I16 R20 R21 P23 K53 M54 Y55 S56 R57 R61 R68 R70 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2j37, PDBe:2j37, PDBj:2j37
PDBsum2j37
PubMed17086193
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]