Structure of PDB 2ihs Chain B Binding Site BS01

Receptor Information
>2ihs Chain B (length=195) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKPARIDILLDMPPASRDLQLKHSWNSEDRSLNIFVKEDDKLTFHRHPVA
QSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSVGYQS
LVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILAFLVPDKFLVALDMDE
GTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIGGL
Ligand information
>2ihs Chain D (length=20) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DINNNNNIVEDVERKREFYI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ihs Structural Basis for Protein Recognition by B30.2/SPRY Domains
Resolution2.2 Å
Binding residue
(original residue number in PDB)		S66 L67 N68 R81 P83 V84 A85 G114 T115 H129 Y133 V220 W221 G222
Binding residue
(residue number reindexed from 1)		S31 L32 N33 R46 P48 V49 A50 G79 T80 H94 Y98 V181 W182 G183
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ihs, PDBe:2ihs, PDBj:2ihs
PDBsum2ihs
PubMed17189197
UniProtA1Z6E0|GUS_DROME Protein gustavus (Gene Name=gus)

[Back to BioLiP]