Structure of PDB 2ian Chain B Binding Site BS01

Receptor Information
>2ian Chain B (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTE
LGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVY
PSHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLV
MLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ian Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
Resolution2.8 Å
Binding residue
(original residue number in PDB)		F13 D57 W61 Q70 R71 A74 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		F11 D55 W59 Q68 R69 A72 Y76 H79 N80 V83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ian, PDBe:2ian, PDBj:2ian
PDBsum2ian
PubMed17334368
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]