Structure of PDB 2iam Chain B Binding Site BS01

Receptor Information

>2iam Chain B (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVT
VYPSNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTL
VMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA

Ligand information

>2iam Chain P (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GELIGILNAAKVPAD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2iam Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
Resolution	2.8 Å
Binding residue (original residue number in PDB)	L11 D57 W61 Q70 R71 Y78 H81 N82 V85
Binding residue (residue number reindexed from 1)	L11 D57 W61 Q70 R71 Y78 H81 N82 V85

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2iam, PDBe:2iam, PDBj:2iam
PDBsum	2iam
PubMed	17334368
UniProt	P01911\|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]