Structure of PDB 2i3q Chain B Binding Site BS01

Receptor Information
>2i3q Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIAPNQSYKFKHQLSLTFVVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i3q Homing endonuclease I-CreI derivatives with novel DNA target specificities.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S332 Y333 K334 Q338 R368 R370 E380 I381 K416 D437 K439
Binding residue
(residue number reindexed from 1)		S31 Y32 K33 Q37 R67 R69 E79 I80 K115 D136 K138
Enzymatic activity
Catalytic site (original residue number in PDB) G319 D320
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2i3q, PDBe:2i3q, PDBj:2i3q
PDBsum2i3q
PubMed16971456
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]