Structure of PDB 2i0q Chain B Binding Site BS01

Receptor Information
>2i0q Chain B (length=216) Species: 200597 (Sterkiella nova) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYFF
VAPYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFTS
YANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQA
AINKTVKGDNLVDISKVADAAGKKGKVDAGIVKASASKGDEFSDFSFKEG
NTATLKIADIFVQEKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i0q Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		E45 H49 F106 Y109 Y134 R140 K145
Binding residue
(residue number reindexed from 1)		E37 H41 F98 Y101 Y126 R132 K137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042162 telomeric DNA binding
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0016233 telomere capping
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000782 telomere cap complex
GO:0005634 nucleus
GO:0005694 chromosome
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2i0q, PDBe:2i0q, PDBj:2i0q
PDBsum2i0q
PubMed17082188
UniProtP16458|TEBB_STENO Telomere-binding protein subunit beta (Gene Name=MAC-41A)

[Back to BioLiP]